Skip to content

andrewdalpino/ESMC-Function-Classifier

Repository files navigation

ESMC Protein Function Predictor

An Evolutionary-scale Model (ESM) for protein function prediction from amino acid sequences using the Gene Ontology (GO). Based on the ESM Cambrian Transformer architecture, pre-trained on UniRef, MGnify, and the Joint Genome Institute's database and fine-tuned on the AmiGO Boost protein function dataset, this model predicts the GO subgraph for a particular protein sequence - giving you insight into the molecular function, biological process, and location of the activity inside the cell.

What are GO terms?

"The Gene Ontology (GO) is a concept hierarchy that describes the biological function of genes and gene products at different levels of abstraction (Ashburner et al., 2000). It is a good model to describe the multi-faceted nature of protein function."

"GO is a directed acyclic graph. The nodes in this graph are functional descriptors (terms or classes) connected by relational ties between them (is_a, part_of, etc.). For example, terms 'protein binding activity' and 'binding activity' are related by an is_a relationship; however, the edge in the graph is often reversed to point from binding towards protein binding. This graph contains three subgraphs (subontologies): Molecular Function (MF), Biological Process (BP), and Cellular Component (CC), defined by their root nodes. Biologically, each subgraph represent a different aspect of the protein's function: what it does on a molecular level (MF), which biological processes it participates in (BP) and where in the cell it is located (CC)."

From CAFA 5 Protein Function Prediction

Pretrained Models

The following pretrained models are available on HuggingFace Hub.

Name Embedding Dim. Attn. Heads Encoder Layers Context Length QAT Total Parameters
andrewdalpino/ESMC-300M-Protein-Function 960 15 30 2048 None 361M
andrewdalpino/ESMC-300M-QAT-Protein-Function 960 15 30 2048 Int8W 361M
andrewdalpino/ESMC-600M-Protein-Function 1152 18 36 2048 None 644M
andrewdalpino/ESMC-600M-QAT-Protein-Function 1152 18 36 2048 Int8W 644M

Basic Pretrained Example

First, install the esmc_function_classifier package using pip.

pip install esmc_function_classifier

Then, we'll load the model weights from HuggingFace Hub, tokenize the amino acid sequence, and infer the GO terms.

import torch

from esm.tokenization import EsmSequenceTokenizer

from esmc_function_classifier.model import EsmcGoTermClassifier


model_name = "andrewdalpino/ESMC-300M-Protein-Function"

sequence = "MPPKGHKKTADGDFRPVNSAGNTIQAKQKYSIDDLLYPKSTIKNLAKETLPDDAIISKDALTAIQRAATLFVSYMASHGNASAEAGGRKKIT"

top_p = 0.5

tokenizer = EsmSequenceTokenizer()

model = EsmcGoTermClassifier.from_pretrained(model_name)

out = tokenizer(sequence, max_length=2048, truncation=True)

input_ids = torch.tensor(out["input_ids"], dtype=torch.int64)

go_term_probabilities = model.predict_terms(
    input_ids, top_p=top_p
)

You can also output the gene-ontology (GO) networkx subgraph for a given sequence like in the example below. You'll need an up-to-date gene ontology database that you can import using the obonet package.

pip install obonet
import networkx as nx

import obonet


# Visit https://geneontology.org/docs/download-ontology/ to download.
go_db_path = "./dataset/go-basic.obo"

graph = obonet.read_obo(go_db_path)

model.load_gene_ontology(graph)

subgraph, go_term_probabilities = model.predict_subgraph(
    input_ids, top_p=top_p
)

json = nx.node_link_data(subgraph)

print(json)

Quantized Model

To quantize the model weights using int8 call the quantize_weights() method. Any model can be quantized, but we recommend one that has been quantization-aware trained (QAT) for the best performance. The group_size argument controls the granularity at which quantization scales are computed.

model.quantize_weights(group_size=64)

Cloning the Repo

You'll need the code in the repository to fine-tune and export your own models. To clone the repo onto your local machine enter the command like in the example below.

git clone https://github.com/andrewdalpino/ESMC-Function-Classifier

Install Project Dependencies

Project dependencies are specified in the requirements.txt file. You can install them with pip using the following command from the project root. We recommend using a virtual environment such as venv to keep package dependencies on your system tidy.

python -m venv ./.venv

source ./.venv/bin/activate

pip install -r requirements.txt

Fine-tuning

We'll be fine-tuning the pre-trained ESMC model with a multi-label binary classification head on the AmiGO Boost dataset of GO term-annotated protein sequences. To begin training with the default arguments, you can enter the command below.

python fine-tune.py

You can change the base model and dataset subset like in the example below.

python fine-tune.py --base_model="esmc_600m" --dataset_subset="biological_process"

You can also adjust the batch_size, gradient_accumulation_steps, and learning_rate like in the example below.

python fine-tune.py --batch_size=16 --gradient_accumulation_step=8 --learning_rate=5e-4

Training checkpoints will be saved at the checkpoint_path location. You can change the location and the checkpoint_interval like in the example below.

python fine-tune.py --checkpoint_path="./checkpoints/biological-process-large.pt" --checkpoint_interval=3

If you would like to resume training from a previous checkpoint, make sure to add the resume argument. Note that if the checkpoint path already exists, the file will be overwritten.

python fine-tune.py --checkpoint_path="./checkpoints/checkpoint.pt" --resume

Quantization-tuning

To simulate int4 quantized weights during training we can insert fake quantized tensors into the model and train like normal. The quantized model should perform better at inference time when some or all training epochs employ quantization-aware training.

python fine-tune.py --quantization_aware_training --quant_group_size=64 --resume

Training Arguments

Argument Default Type Description
--base_model esmc_300m str The base model name, choose from esmc_300m, esmc_600m.
--dataset_subset "all" str The subset of the dataset to train on, choose from all, mf for molecular function, cc for cellular component, or bp for biological process.
--num_dataset_processes 1 int The number of CPU processes to use to process and load samples.
--min_sequence_length 1 int The minimum length of the input sequences.
--max_sequence_length 2048 int The maximum length of the input sequences.
--unfreeze_last_k_layers 7 int Fine-tune the last k layers of the pre-trained encoder network.
--quantization_aware_training False bool Should we add fake quantized tensors to simulate quantized training?
--quant_group_size 64 int The number of channels to group together when computing quantizations.
--batch_size 8 int The number of samples to pass through the network at a time.
--gradient_accumulation_steps 16 int The number of batches to pass through the network before updating the weights.
--max_gradient_norm 1.0 float Clip gradients above this threshold norm before stepping.
--learning_rate 5e-4 float The learning rate of the Adam optimizer.
--num_epochs 50 int The number of epochs to train for.
--classifier_hidden_ratio 1 {1, 2, 4} The ratio of hidden nodes to embedding dimensions in the classifier head.
--eval_interval 2 int Evaluate the model after this many epochs on the testing set.
--checkpoint_interval 2 int Save the model parameters to disk every this many epochs.
--checkpoint_path "./checkpoints/checkpoint.pt" string The path to the training checkpoint.
--resume False bool Should we resume training from the last checkpoint?
--run_dir_path "./runs" str The path to the TensorBoard run directory for this training session.
--device "cuda" str The device to run the computation on ("cuda", "cuda:1", "mps", "cpu", etc).
--seed None int The seed for the random number generator.

Training Dashboard

We use TensorBoard to capture and display training events such as loss and gradient norm updates. To launch the dashboard server run the following command from the terminal.

tensorboard --logdir=./runs

GO Subgraph Prediction

We can also infer the gene ontology subgraph of a particular sequence. The predict-subgraph.py script outputs a graphical representation of the predictions where green nodes have high probability and pink nodes have low probability.

python predict-subgraph.py --checkpoint_path="./checkpoints/checkpoint.pt" --top_p=0.1
Checkpoint loaded successfully
Enter a sequence: MPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTG

Example GO Subgraph

Prediction Arguments

Argument Default Type Description
--checkpoint_path "./checkpoints/checkpoint.pt" str The path to the training checkpoint.
--quantize_weights False bool Should we quantize the weights of the model?
--quant_group_size 64 int The number of channels to group together when computing quantizations.
--go_db_path "./dataset/go-basic.obo" str The path to the Gene Ontology basic obo file.
--context_length 2048 int The maximum length of the input sequences.
--top_p 0.5 float Only display nodes with the top p probability.
--device "cuda" str The device to run the computation on ("cuda", "cuda:1", "mps", "cpu", etc).
--seed None int The seed for the random number generator.

References:

  • T. Hayes, et al. Simulating 500 million years of evolution with a language model, 2024.
  • M. Ashburner, et al. Gene Ontology: tool for the unification of biology, 2000.

About

An Evolutionary-scale Model (ESM) for protein function prediction from amino acid sequences using the Gene Ontology (GO).

Topics

Resources

License

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors